PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009761m
Common NameCARUB_v10009761mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 322aa    MW: 36684.6 Da    PI: 9.0121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009761mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.28.8e-1961108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+llvd+++++G g+W++ +r  g+ R++k+c++rw +yl
  Carubv10009761m  61 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 108
                      79********************************************97 PP

2Myb_DNA-binding56.46.8e-18114158147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++Edel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Carubv10009761m 114 RGNFSEDEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 158
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-2552111IPR009057Homeodomain-like
PROSITE profilePS5129418.15356108IPR017930Myb domain
SuperFamilySSF466891.44E-3059155IPR009057Homeodomain-like
SMARTSM007172.6E-1460110IPR001005SANT/Myb domain
PfamPF002492.0E-1661108IPR001005SANT/Myb domain
CDDcd001671.95E-1163108No hitNo description
PROSITE profilePS5129428.394109163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-27112163IPR009057Homeodomain-like
SMARTSM007173.7E-17113161IPR001005SANT/Myb domain
PfamPF002493.3E-16114158IPR001005SANT/Myb domain
CDDcd001679.68E-12116159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MELSLFSFQI ILKKIYIQTP NFSKIHTYIH THRDTYRDRR RRRTFKEMGR SPCCEKAHMN  60
KGAWTKEEDQ LLVDYIRKHG EGCWRSLPRA AGLQRCGKSC RLRWMNYLRP DLKRGNFSED  120
EDELIIKLHS LLGNKWSLIA GRLPGRTDNE IKNYWNTHIK RKLLSRGIDP NTHRLINDSA  180
AASALVVLPP PPPHPLSLQN DDVVEPLRID LAGPVKPEPV LREEIGFNNC TSSGTTSEKD  240
FGNEGDWVLN LELSVGPAAT SYHRYESSRK ASVVDSAEST RRWGSELFGG AQSDAVCLCC  300
RVGLFHNESC RNCRNSDVRT H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29611637108B-MYB
1h8a_C1e-285916325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13843RRRRRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0725431e-180AY072543.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305372.10.0hypothetical protein CARUB_v10009761mg
SwissprotQ9S9K91e-163MYB3_ARATH; Transcription factor MYB3
TrEMBLR0IIJ80.0R0IIJ8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2457__AT1G22640.11e-162(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-160myb domain protein 3